ELISA Recombinant Psychromonas ingrahamii UPF0316 protein Ping_1367 (Ping_1367)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Psychromonas ingrahamii (strain 37) Uniprot NO.:A1SUM3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPLVFFARVADVSLGTFRTIVIFRGHKFLASFIGFFEIIIWLVASAQVLTNLDQWYLALA YASGFSVGNYAGISIENRFAIGNELIRCISFNRDVLAGKLREEGFKVVSFDGDMGEAYPV ELLLVIEKRRNVPSLIQLIKDLDPTAVYSVSDVKSVYEGPDIFPRRSLLHSTLmLLGKR Protein Names:Recommended name: UPF0316 protein Ping_1367 Gene Names:Ordered Locus Names:Ping_1367 Expression Region:1-179 Sequence Info:fµLl length protein