ELISA Recombinant Haemophilus influenzae UPF0756 membrane protein CGSHiGG_08995 (CGSHiGG_08995)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Haemophilus influenzae (strain PittGG)
Uniprot NO.:A5UIJ7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTLQLNTIALLLVILLILGVLSNNSAITISAAVLLIMQQTFLSSHIPLLEKYGVKIGIII LTIGVLSPLVSGKIQLPDLSGFLSWKMALSISVGVLVAWLAGKGVPLMGEQPILVTGLLI GTIIGVAFLGGIPVGPLIAAGILALLLGKI
Protein Names:Recommended name: UPF0756 membrane protein CGSHiGG_08995
Gene Names:Ordered Locus Names:CGSHiGG_08995
Expression Region:1-150
Sequence Info:fµLl length protein
Our Products !
Check our Lab !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.