Skip to Content

ELISA Recombinant Ostreid herpesvirus 1 Uncharacterized protein ORF36(ORF36)

https://www.x-zyme.com/web/image/product.template/148667/image_1920?unique=90f0e4f
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Ostreid herpesvirus 1 (isolate France) (OsHV-1) (Pacific oyster herpesvirus) Uniprot NO.:Q6R7I8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSTTEQTVCEIEQESELIPAKPQYIIVKKPKRQAWQRVLLLFRIINMIVIWAALIALFVK LYILRGPIPRSYFHY Protein Names:Recommended name: Uncharacterized protein ORF36 Gene Names:ORF Names:ORF36 Expression Region:1-75 Sequence Info:fµLl length protein

1,414.00 € 1414.0 EUR 1,414.00 €

1,414.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check our Lab  !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.