Skip to Content

ELISA Recombinant Triggering receptor expressed on myeloid cells 2(TREM2),partial

https://www.x-zyme.com/web/image/product.template/140103/image_1920?unique=45d657d
Quantity: 200µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 10-20 working days Research Topic: Immunology Uniprot ID: Q9NZC2 Gene Names: TREM2 Organism: Homo sapiens () AA Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTS Expression Region: 19-174aa Sequence Info: ExtracellµLar Domain Source: E.coli Tag Info: N-terminal 6xHis-tagged MW: 21.4 kDa Alternative Name(s): Triggering receptor expressed on monocytes 2 Relevance: May have a role in chronic inflammations and may stimµLate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. Reference: "Inflammatory responses can be triggered by TREM-1, a novel receptor expressed on neutrophils and monocytes."Bouchon A., Dietrich J., Colonna M.J. Immunol. 164:4991-4995(2000) Purity: Greater than 90% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer,50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

709.00 € 709.0 EUR 709.00 €

709.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check our Lab  !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.